EXOSC10 antibody (C-Term)

Catalog No. ABIN629904

Product Details anti-EXOSC10 Antibody

Target: EXOSC10 (Exosome Component 10 (EXOSC10))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOSC10 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: EXOSC10 antibody was raised against the C terminal of EXOSC10

Purification: Purified

Immunogen: EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOSC10 Blocking Peptide, catalog no. 33R-2842, is also available for use as a blocking control in assays to test for specificity of this EXOSC10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOSC10

Target: EXOSC10 (Exosome Component 10 (EXOSC10))

Alternative Name: EXOSC10 (EXOSC10 Products)

Synonyms: Pmscl2 antibody, zgc:55695 antibody, pm-scl antibody, pm/scl-100 antibody, pmscl antibody, pmscl2 antibody, rrp6 antibody, rrp6p antibody, EXOSC10 antibody, 201.t00018 antibody, 21.m02990 antibody, DDBDRAFT_0203581 antibody, DDBDRAFT_0233752 antibody, DDB_0203581 antibody, DDB_0233752 antibody, PM-Scl antibody, PM/Scl-100 antibody, PMSCL antibody, PMSCL2 antibody, RRP6 antibody, Rrp6p antibody, p2 antibody, p3 antibody, p4 antibody, exosome component 10 antibody, 3'-5' exonuclease antibody, exosome component 10 L homeolog antibody, exosc10 antibody, EXOSC10 antibody, EHI_021400 antibody, BBOV_IV002650 antibody, CpipJ_CPIJ003896 antibody, CMU_031760 antibody, Tsp_05247 antibody, exosc10.L antibody, Exosc10 antibody

Background: EXOSC10 contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.

Molecular Weight: 97 kDa (MW of target protein)