DRB1 antibody (N-Term)

Catalog No. ABIN629925

Product Details anti-DRB1 Antibody

Target: DRB1 (Dopamine Receptor Binding 1 (DRB1))

Binding Specificity: N-Term

Reactivity: Mouse, Rat, Dog, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DRB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DRB1 antibody was raised against the N terminal of DRB1

Purification: Purified

Immunogen: DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DRB1 Blocking Peptide, catalog no. 33R-5829, is also available for use as a blocking control in assays to test for specificity of this DRB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DRB1

Target: DRB1 (Dopamine Receptor Binding 1 (DRB1))

Alternative Name: DRB1 (DRB1 Products)

Synonyms: dopamine receptor binding 1 antibody, Drb1 antibody

Background: DRB1 is RNA-binding protein with binding specificity for poly(C) and may play an important role in neural development.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: TCR Signaling, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events