NXF5 antibody (Middle Region)
-
- Target See all NXF5 Antibodies
- NXF5 (Nuclear RNA Export Factor 5 (NXF5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NXF5 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- NXF5 antibody was raised against the middle region of NXF5
- Purification
- Purified
- Immunogen
- NXF5 antibody was raised using the middle region of NXF5 corresponding to a region with amino acids ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE
- Top Product
- Discover our top product NXF5 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NXF5 Blocking Peptide, catalog no. 33R-4173, is also available for use as a blocking control in assays to test for specificity of this NXF5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NXF5 (Nuclear RNA Export Factor 5 (NXF5))
- Alternative Name
- NXF5 (NXF5 Products)
- Synonyms
- NXF2B antibody, nuclear RNA export factor 5 antibody, nuclear RNA export factor 2 antibody, NXF5 antibody, LOC609849 antibody, Nxf5 antibody
- Background
- NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.
- Molecular Weight
- 44 kDa (MW of target protein)
-