MATR3 antibody (C-Term)
-
- Target See all MATR3 Antibodies
- MATR3 (Matrin 3 (MATR3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MATR3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Matrin 3 antibody was raised against the C terminal of MATR3
- Purification
- Purified
- Immunogen
- Matrin 3 antibody was raised using the C terminal of MATR3 corresponding to a region with amino acids ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG
- Top Product
- Discover our top product MATR3 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Matrin 3 Blocking Peptide, catalog no. 33R-1084, is also available for use as a blocking control in assays to test for specificity of this Matrin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATR3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MATR3 (Matrin 3 (MATR3))
- Alternative Name
- Matrin 3 (MATR3 Products)
- Synonyms
- MPD2 antibody, VCPDM antibody, 1110061A14Rik antibody, 2810017I02Rik antibody, AI841759 antibody, AW555618 antibody, D030046F20Rik antibody, mKIAA0723 antibody, P130/MAT3 antibody, matrin-3 antibody, matr3 antibody, MGC79524 antibody, MATR3 antibody, DKFZp459A057 antibody, DKFZp459A162 antibody, DKFZp459F0515 antibody, DKFZp469A1933 antibody, LOC100232255 antibody, KIAA0723 antibody, matrin 3 antibody, matrin 3 S homeolog antibody, MATR3 antibody, Matr3 antibody, matr3.S antibody, matr3 antibody
- Background
- MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.
- Molecular Weight
- 94 kDa (MW of target protein)
-