MRM1 antibody
-
- Target See all MRM1 Antibodies
- MRM1 (Mitochondrial rRNA Methyltransferase 1 Homolog (MRM1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MRM1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- MRM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQ
- Top Product
- Discover our top product MRM1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MRM1 Blocking Peptide, catalog no. 33R-3623, is also available for use as a blocking control in assays to test for specificity of this MRM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRM1 (Mitochondrial rRNA Methyltransferase 1 Homolog (MRM1))
- Alternative Name
- MRM1 (MRM1 Products)
- Synonyms
- A530065E19Rik antibody, ENSMUSG00000054212 antibody, RGD1566232 antibody, mitochondrial rRNA methyltransferase 1 antibody, MRM1 antibody, Mrm1 antibody
- Background
- MRM1 belongs to the RNA methyltransferase trmH family and probably methylates the ribose of guanosine G-2270 in the peptidyl transferase center of the mitochondrial large ribosomal RNA (21S)
- Molecular Weight
- 18 kDa (MW of target protein)
-