SFPQ antibody

Catalog No. ABIN629995

Product Details anti-SFPQ Antibody

Target: SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFPQ antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFPQ Blocking Peptide, catalog no. 33R-9727, is also available for use as a blocking control in assays to test for specificity of this SFPQ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFPQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFPQ

Target: SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))

Alternative Name: SFPQ (SFPQ Products)

Synonyms: 1110004P21Rik antibody, 2810416M14Rik antibody, 5730453G22Rik antibody, 9030402K04Rik antibody, AU021830 antibody, D4Ertd314e antibody, Gm12940 antibody, OTTMUSG00000009329 antibody, PSF antibody, REP1 antibody, hm:zeh0027 antibody, wu:fa11h12 antibody, wu:fd10f03 antibody, zgc:85935 antibody, POMP100 antibody, splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated) antibody, splicing factor proline/glutamine-rich antibody, splicing factor proline and glutamine rich antibody, Sfpq antibody, sfpq antibody, SFPQ antibody

Background: SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A.

Molecular Weight: 78 kDa (MW of target protein)