Seryl-tRNA Synthetase (SARS) (Middle Region) antibody
-
- Target See all Seryl-tRNA Synthetase (SARS) Antibodies
- Seryl-tRNA Synthetase (SARS)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SARS antibody was raised against the middle region of SARS
- Purification
- Purified
- Immunogen
- SARS antibody was raised using the middle region of SARS corresponding to a region with amino acids SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL
- Top Product
- Discover our top product SARS Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SARS Blocking Peptide, catalog no. 33R-8713, is also available for use as a blocking control in assays to test for specificity of this SARS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Seryl-tRNA Synthetase (SARS)
- Alternative Name
- SARS (SARS Products)
- Synonyms
- SERRS antibody, SERS antibody, Sars1 antibody, Strs antibody, serRS antibody, SerRS antibody, wu:fk51f08 antibody, zgc:92152 antibody, seryl-tRNA synthetase antibody, seryl-aminoacyl-tRNA synthetase antibody, SARS antibody, Sars antibody, sars antibody
- Background
- SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.
- Molecular Weight
- 57 kDa (MW of target protein)
-