RPL32 antibody (N-Term)

Catalog No. ABIN630044

Product Details anti-RPL32 Antibody

Target: RPL32 (Ribosomal Protein L32 (RPL32))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL32 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPL32 antibody was raised against the N terminal of RPL32

Purification: Purified

Immunogen: RPL32 antibody was raised using the N terminal of RPL32 corresponding to a region with amino acids AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL32 Blocking Peptide, catalog no. 33R-1035, is also available for use as a blocking control in assays to test for specificity of this RPL32 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL32

Target: RPL32 (Ribosomal Protein L32 (RPL32))

Alternative Name: RPL32 (RPL32 Products)

Synonyms: L32 antibody, AU020185 antibody, rpL32-3A antibody, zgc:136952 antibody, 143250_at antibody, BcDNA:RH03940 antibody, CG7939 antibody, Dmel\\CG7939 antibody, M(3)99D antibody, RP-49 antibody, RP49 antibody, RPL32 antibody, Rp-49 antibody, Rp49 antibody, Rp49/RpL32 antibody, Rpl32 antibody, bs30a02.y1 antibody, rp49 antibody, rp49/RpL32 antibody, ribosomal protein L32 antibody, 50S ribosomal protein L32 antibody, rpl32 antibody, ribosomal protein L32 L homeolog antibody, Ribosomal protein L32 antibody, ribosomal protein L32 homolog32 antibody, RPL32 antibody, rpl32 antibody, Rpl32 antibody, rpl32.L antibody, RpL32 antibody

Background: RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molecular Weight: 15 kDa (MW of target protein)