CLCN3 antibody (C-Term)
-
- Target See all CLCN3 Antibodies
- CLCN3 (Chloride Channel 3 (CLCN3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLCN3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- CLCN3 antibody was raised against the C terminal of CLCN3
- Purification
- Purified
- Immunogen
- CLCN3 antibody was raised using the C terminal of CLCN3 corresponding to a region with amino acids MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD
- Top Product
- Discover our top product CLCN3 Primary Antibody
-
anti-Chloride Channel 3 (CLCN3) (C-Term) antibody
CLCN3 Reactivity: Rat, Human, Mouse, Guinea Pig, Rabbit, Dog, Zebrafish (Danio rerio), Horse, Cow, Sheep WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Chloride Channel 3 (CLCN3) (N-Term) antibodyCLCN3 Reactivity: Rat, Human, Mouse WB, IHC, ELISA Host: Rabbit Polyclonal unconjugated
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibodyCLCN3 Reactivity: Rat WB, IHC, ICC, IF Host: Mouse Monoclonal S258-5 unconjugated
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (HRP)CLCN3 Reactivity: Rat WB, IHC, ICC, IF Host: Mouse Monoclonal S258-5 HRP
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (FITC)CLCN3 Reactivity: Rat WB, IHC, ICC, IF Host: Mouse Monoclonal S258-5 FITC
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (Biotin)CLCN3 Reactivity: Rat WB, IHC, ICC, IF Host: Mouse Monoclonal S258-5 Biotin
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (PE)CLCN3 Reactivity: Rat WB, IHC, ICC, IF Host: Mouse Monoclonal S258-5 PE
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (APC)CLCN3 Reactivity: Rat WB, IHC, ICC, IF Host: Mouse Monoclonal S258-5 APC
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (PerCP)CLCN3 Reactivity: Rat WB, IHC, ICC, IF Host: Mouse Monoclonal S258-5 PerCP
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (Atto 594)CLCN3 Reactivity: Rat WB, IHC, ICC, IF Host: Mouse Monoclonal S258-5 Atto 594
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CLCN3 Blocking Peptide, catalog no. 33R-5956, is also available for use as a blocking control in assays to test for specificity of this CLCN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLCN3 (Chloride Channel 3 (CLCN3))
- Alternative Name
- CLCN3 (CLCN3 Products)
- Synonyms
- CLC3 antibody, ClC-3 antibody, Clc3 antibody, CLCN3 antibody, fb78c02 antibody, wu:fb78c02 antibody, clc3 antibody, clc-3 antibody, chloride voltage-gated channel 3 antibody, chloride channel, voltage-sensitive 3 antibody, chloride channel 3 antibody, chloride channel protein 3 antibody, chloride channel, voltage-sensitive 3 S homeolog antibody, CLCN3 antibody, Clcn3 antibody, clcn3 antibody, PTRG_03131 antibody, BDBG_05668 antibody, MCYG_04420 antibody, clcn3.S antibody
- Background
- CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).
- Molecular Weight
- 95 kDa (MW of target protein)
-
