KCTD10 antibody (N-Term)

Catalog No. ABIN630076

Product Details anti-KCTD10 Antibody

Target: KCTD10 (Potassium Channel Tetramerisation Domain Containing 10 (KCTD10))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCTD10 antibody was raised against the N terminal of KCTD10

Purification: Purified

Immunogen: KCTD10 antibody was raised using the N terminal of KCTD10 corresponding to a region with amino acids MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD10 Blocking Peptide, catalog no. 33R-5908, is also available for use as a blocking control in assays to test for specificity of this KCTD10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD10

Target: KCTD10 (Potassium Channel Tetramerisation Domain Containing 10 (KCTD10))

Alternative Name: KCTD10 (KCTD10 Products)

Synonyms: kctd10 antibody, KCTD10 antibody, wu:fb30g12 antibody, zgc:63846 antibody, AW536343 antibody, C87062 antibody, mBACURD3 antibody, BTBD28 antibody, ULRO61 antibody, hBACURD3 antibody, potassium channel tetramerization domain containing 10 antibody, potassium channel tetramerisation domain containing 10 antibody, potassium channel tetramerization domain containing 10 L homeolog antibody, KCTD10 antibody, kctd10 antibody, Kctd10 antibody, kctd10.L antibody

Background: KCTD10, a rat potassium channel tetramerisation domain-containing 10 gene is a novel member of the polymerase delta-interacting protein 1 (PDIP1) gene family. KCTD10 shares significant similarity in amino acid sequence to PDIP1 and can interact with the small subunit of DNA polymerase delta and PCNA as PDIP1 does. Like PDIP1, the expression of KCTD10 gene can be induced by TNF-alpha in NIH3T3 cells.

Molecular Weight: 34 kDa (MW of target protein)