RGS antibody (N-Term)

Catalog No. ABIN630222

Product Details anti-RGS Antibody

Target: RGS (Regulator of G-Protein Signaling 9 (RGS))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RGS9 antibody was raised against the N terminal of RGS9

Purification: Purified

Immunogen: RGS9 antibody was raised using the N terminal of RGS9 corresponding to a region with amino acids MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ

Application Details

Application Notes: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS9 Blocking Peptide, catalog no. 33R-6633, is also available for use as a blocking control in assays to test for specificity of this RGS9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS

Target: RGS (Regulator of G-Protein Signaling 9 (RGS))

Alternative Name: RGS9 (RGS Products)

Synonyms: LOC100218209 antibody, RGS9-1 antibody, Rgs9-2 antibody, PERRS antibody, RGS9L antibody, regulator of G-protein signaling 9 antibody, regulator of G protein signaling 9 antibody, RGS9 antibody, Tsp_08067 antibody, Rgs9 antibody

Background: RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction