APOBEC3G antibody (N-Term)

Catalog No. ABIN630226

This Rabbit Polyclonal antibody specifically detects APOBEC3G in WB. It exhibits reactivity toward Human.

Quick Overview for APOBEC3G antibody (N-Term) (ABIN630226)

Target: APOBEC3G (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOBEC3G antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APOBEC3G Antibody

Binding Specificity: N-Term

Specificity: ApoBEC3 G antibody was raised against the N terminal of APOBEC3

Purification: Purified

Immunogen: ApoBEC3 G antibody was raised using the N terminal of APOBEC3 corresponding to a region with amino acids AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoBEC3G Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ApoBEC3G antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOBEC3G

Target: APOBEC3G (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G))

Alternative Name: ApoBEC3G

Background: Anti-APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.

Molecular Weight: 46 kDa (MW of target protein)