ZDHHC13 antibody (N-Term)

Catalog No. ABIN630234

Product Details anti-ZDHHC13 Antibody

Target: ZDHHC13 (Zinc Finger, DHHC-Type Containing 13 (ZDHHC13))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZDHHC13 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ZDHHC13 antibody was raised against the N terminal of ZDHHC13

Purification: Purified

Immunogen: ZDHHC13 antibody was raised using the N terminal of ZDHHC13 corresponding to a region with amino acids MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZDHHC13 Blocking Peptide, catalog no. 33R-6586, is also available for use as a blocking control in assays to test for specificity of this ZDHHC13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZDHHC13

Target: ZDHHC13 (Zinc Finger, DHHC-Type Containing 13 (ZDHHC13))

Alternative Name: ZDHHC13 (ZDHHC13 Products)

Synonyms: ZDHHC13 antibody, 2410004E01Rik antibody, C530010M18 antibody, HIP3RP antibody, Hip14l antibody, kojak antibody, skc4 antibody, wu:fb06e01 antibody, wu:fc39g10 antibody, wu:fi22e09 antibody, zgc:101690 antibody, HIP14L antibody, zinc finger DHHC-type containing 13 antibody, zinc finger, DHHC domain containing 13 antibody, zinc finger, DHHC-type containing 13 antibody, ZDHHC13 antibody, Zdhhc13 antibody, zdhhc13 antibody

Background: ZDHHC13 may be involved in the NF-kappa-B signaling pathway.

Molecular Weight: 54 kDa (MW of target protein)