NELL2 antibody

Catalog No. ABIN630282

Product Details anti-NELL2 Antibody

Target: NELL2 (NEL-Like 2 (Chicken) (NELL2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NELL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: NELL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NELL2 Blocking Peptide, catalog no. 33R-5966, is also available for use as a blocking control in assays to test for specificity of this NELL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NELL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NELL2

Target: NELL2 (NEL-Like 2 (Chicken) (NELL2))

Alternative Name: NELL2 (NELL2 Products)

Synonyms: A330108N19Rik antibody, R75516 antibody, mel91 antibody, nel antibody, NRP2 antibody, nell2 antibody, wu:fj43h11 antibody, zgc:158375 antibody, neural EGFL like 2 L homeolog antibody, NEL-like 2 antibody, neural EGFL like 2 antibody, neural EGFL like 2a antibody, nell2.L antibody, Nell2 antibody, NELL2 antibody, nell2a antibody

Background: NELL2 is a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. Heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis.

Molecular Weight: 91 kDa (MW of target protein)