Reticulon 2 antibody (N-Term)

Catalog No. ABIN630331

Product Details anti-Reticulon 2 Antibody

Target: Reticulon 2 (RTN2)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Reticulon 2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RTN2 antibody was raised against the N terminal of RTN2

Purification: Purified

Immunogen: RTN2 antibody was raised using the N terminal of RTN2 corresponding to a region with amino acids MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RTN2 Blocking Peptide, catalog no. 33R-6064, is also available for use as a blocking control in assays to test for specificity of this RTN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Reticulon 2

Target: Reticulon 2 (RTN2)

Alternative Name: RTN2 (RTN2 Products)

Synonyms: rtn2 antibody, RTN2 antibody, nsp2 antibody, nspl1 antibody, xrtn2 antibody, RTN2-A antibody, TTpA048i08 antibody, NSP2 antibody, NSPL1 antibody, NSPLI antibody, SPG12 antibody, RTN2-B antibody, RTN2-C antibody, MMS10-P antibody, Ms10p antibody, Nspl1 antibody, reticulon 2 antibody, reticulon-2 antibody, reticulon 2 L homeolog antibody, reticulon 2 (Z-band associated protein) antibody, rtn2 antibody, RTN2 antibody, LOC484444 antibody, Rtn2 antibody, rtn2.L antibody

Background: This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.

Molecular Weight: 51 kDa (MW of target protein)