»
Antibodies
»
anti-ATP-Binding Cassette, Sub-Family G (WHITE), Member 2 (ABCG2) antibody
ATP-Binding Cassette, Sub-Family G (WHITE), Member 2 (ABCG2) antibody
| Antigen |
|
| Synonyms |
MRX, MXR, ABCP, BCRP, BMDP, MXR1, ABC15, BCRP1, CD338, CDw338, EST157481, MGC102821, Bcrp1, AI428558, ABCG2, MGC127688, bcrp |
| Clonality |
Polyclonal |
|
Host
|
|
|
Application
|
 Alternatives Immunohistochemistry (IHC), Western Blotting (WB)
Flow Cytometry (FACS) (40), Western Blotting (WB) (36), Immunofluorescence (IF) (28), Immunohistochemistry (Frozen Sections) (IHC (fro)) (14), ELISA (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Enzyme Immunoassay (EIA) (6), Immunocytochemistry (ICC) (3), Immunohistochemistry (IHC) (3), ELISA (Detection) (2), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
|
| Catalog no. |
ABIN630346 |
| Quantity |
100 ug (1 mg/ml) (Variants) |
| Price |
410.33 $ Plus shipping costs $35.00
|
| Shipping to |
|
| Availability |
Ships within 5 to 7 Business Days |
|
Alternative name
|
ABCG2
|
|
Immunogen
|
ABCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP
|
|
Description
|
ABCG2 is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.
|
|
Molecular Weight
|
72 kDa (MW of target protein)
|
|
Concentration
|
1 mg/ml
|
|
Purification
|
Total IgG Protein A purified
|
|
Buffer
|
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ABCG2 antibody in PBS
|
|
Storage
|
Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
|
|
Research Area
|
Transporters
|
|
Restrictions
|
For Research Use only
|
Alternatives for antigen "ATP-Binding Cassette, Sub-Family G (WHITE), Member 2 (ABCG2)", type "Antibodies"
|
Hosts
|
Rabbit (34), Mouse (28), Rat (4)
|
|
Reactivities
|
Human (59), Mouse (Murine) (27), Rat (Rattus) (17), Cow (Bovine) (2), Monkey (2), Dog (Canine) (1), Escherichia Coli (E. Coli) (1)
|
|
Applications
|
Flow Cytometry (FACS) (40), Western Blotting (WB) (36), Immunofluorescence (IF) (28), Immunohistochemistry (Frozen Sections) (IHC (fro)) (14), ELISA (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Enzyme Immunoassay (EIA) (6), Immunocytochemistry (ICC) (3), Immunohistochemistry (IHC) (3), ELISA (Detection) (2), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
|
|
Conjugates
|
Biotin (4), PE (3), FITC (2), APC (1), Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), HRP (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)
|
|
Epitopes
|
C-Term (2), Center (2)
|
