SLC26A5 antibody

Catalog No. ABIN630355

Product Details anti-SLC26A5 Antibody

Target: SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC26A5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SLC26 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC26A5 Blocking Peptide, catalog no. 33R-3083, is also available for use as a blocking control in assays to test for specificity of this SLC26A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC26A5

Target: SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))

Alternative Name: SLC26A5 (SLC26A5 Products)

Synonyms: pres antibody, fb73d12 antibody, fb74g12 antibody, wu:fb73d12 antibody, wu:fb74g12 antibody, DFNB61 antibody, PRES antibody, Pres antibody, prestin antibody, solute carrier family 26 (anion exchanger), member 5 antibody, solute carrier family 26 member 5 antibody, solute carrier family 26, member 5 antibody, slc26a5 antibody, SLC26A5 antibody, Slc26a5 antibody

Background: SLC26A5 is a member of the SLC26A/SulP transporter family. SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in its gene have been associated with non-syndromic hearing loss.

Molecular Weight: 81 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Dicarboxylic Acid Transport