ZDHHC17 antibody (Middle Region)

Catalog No. ABIN630405

Product Details anti-ZDHHC17 Antibody

Target: ZDHHC17 (Zinc Finger, DHHC-Type Containing 17 (ZDHHC17))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZDHHC17 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZDHHC17 antibody was raised against the middle region of ZDHHC17

Purification: Purified

Immunogen: ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZDHHC17 Blocking Peptide, catalog no. 33R-2993, is also available for use as a blocking control in assays to test for specificity of this ZDHHC17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZDHHC17

Target: ZDHHC17 (Zinc Finger, DHHC-Type Containing 17 (ZDHHC17))

Alternative Name: ZDHHC17 (ZDHHC17 Products)

Synonyms: A230053P19Rik antibody, BB187739 antibody, D130071N24Rik antibody, Hip14 antibody, HIP14 antibody, HIP3 antibody, HYPH antibody, si:ch211-81a6.1 antibody, zinc finger DHHC-type containing 17 antibody, zinc finger, DHHC domain containing 17 antibody, zinc finger, DHHC-type containing 17 antibody, ZDHHC17 antibody, zdhhc17 antibody, Zdhhc17 antibody

Background: ZDHHC17 is a palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HD. It may be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. It may be involved in the NF-kappa-B signaling pathway and has transforming activity.

Molecular Weight: 44 kDa (MW of target protein)