CDH22 antibody (N-Term)

Catalog No. ABIN630407

Product Details anti-CDH22 Antibody

Target: CDH22 (Cadherin-Like 22 (CDH22))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDH22 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CDH22 antibody was raised against the N terminal of CDH22

Purification: Purified

Immunogen: CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDH22 Blocking Peptide, catalog no. 33R-5040, is also available for use as a blocking control in assays to test for specificity of this CDH22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDH22

Target: CDH22 (Cadherin-Like 22 (CDH22))

Alternative Name: CDH22 (CDH22 Products)

Synonyms: C20orf25 antibody, dJ998H6.1 antibody, cadherin 22 antibody, Cdh22 antibody, CDH22 antibody

Background: CDH22 is a member of the cadherin superfamily. CDH22 is composed of five cadherin repeat domains and a cytoplasmic tail similar to the highly conserved cytoplasmic region of classical cadherins.

Molecular Weight: 73 kDa (MW of target protein)