UGT1A1 antibody (Middle Region)

Catalog No. ABIN630449

Product Details anti-UGT1A1 Antibody

Target: UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT1A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGT1 A1 antibody was raised against the middle region of µgT1 1

Purification: Purified

Immunogen: UGT1 A1 antibody was raised using the middle region of µgT1 1 corresponding to a region with amino acids ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT1A1 Blocking Peptide, catalog no. 33R-1543, is also available for use as a blocking control in assays to test for specificity of this µgT1A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT1A1

Target: UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))

Alternative Name: UGT1A1 (UGT1A1 Products)

Synonyms: BILIQTL1 antibody, GNT1 antibody, HUG-BR1 antibody, UDPGT antibody, UDPGT 1-1 antibody, UGT1 antibody, UGT1A antibody, Gnt1 antibody, UGT1A01 antibody, Udpgt-1a antibody, UgtBr1 antibody, Udpgt antibody, Ugt1 antibody, zgc:123097 antibody, UDP glucuronosyltransferase family 1 member A1 antibody, UDP glucuronosyltransferase 1 family, polypeptide A1 antibody, UDP-glucuronosyltransferase 1-1 antibody, UDP-glucuronosyltransferase antibody, UDP-glucuronosyltransferase 1-6 antibody, UDP glucuronosyltransferase 1 family polypeptide a1 antibody, UGT1A1 antibody, Ugt1a1 antibody, LOC100065342 antibody, LOC100125517 antibody, LOC100229734 antibody, LOC100405984 antibody, LOC100511479 antibody, ugt1a1 antibody

Background: UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha