ST3GAL5 antibody (N-Term)

Catalog No. ABIN630451

Product Details anti-ST3GAL5 Antibody

Target: ST3GAL5 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 5 (ST3GAL5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST3GAL5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ST3 GAL5 antibody was raised against the N terminal of ST3 AL5

Purification: Purified

Immunogen: ST3 GAL5 antibody was raised using the N terminal of ST3 AL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST3GAL5 Blocking Peptide, catalog no. 33R-2160, is also available for use as a blocking control in assays to test for specificity of this ST3GAL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST3GAL5

Target: ST3GAL5 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 5 (ST3GAL5))

Alternative Name: ST3GAL5 (ST3GAL5 Products)

Synonyms: SATI antibody, SIAT9 antibody, SIATGM3S antibody, ST3GalV antibody, ST3GAL-V antibody, 3S-T antibody, Siat9 antibody, [a]2 antibody, ST3 beta-galactoside alpha-2,3-sialyltransferase 5 antibody, ST3GAL5 antibody, St3gal5 antibody

Background: Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. ST3GAL5 is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. It is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in its gene has been associated with Amish infantile epilepsy syndrome.

Molecular Weight: 48 kDa (MW of target protein)