TMED3 antibody (C-Term)
-
- Target See all TMED3 Antibodies
- TMED3 (Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMED3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMED3 antibody was raised against the C terminal of TMED3
- Purification
- Purified
- Immunogen
- TMED3 antibody was raised using the C terminal of TMED3 corresponding to a region with amino acids DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
- Top Product
- Discover our top product TMED3 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMED3 Blocking Peptide, catalog no. 33R-2139, is also available for use as a blocking control in assays to test for specificity of this TMED3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMED3 (Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3))
- Alternative Name
- TMED3 (TMED3 Products)
- Synonyms
- wu:fb09b11 antibody, 1200002G13Rik antibody, AW546672 antibody, P24b antibody, TMED3 antibody, C15orf22 antibody, P24B antibody, p26 antibody, transmembrane p24 trafficking protein 3 antibody, transmembrane emp24 domain-containing protein 3 antibody, tmed3 antibody, LOC100220305 antibody, Tmed3 antibody, TMED3 antibody
- Background
- The function of this gene remains unknown.
- Molecular Weight
- 25 kDa (MW of target protein)
-