RHAG antibody (Middle Region)

Catalog No. ABIN630486

Product Details anti-RHAG Antibody

Target: RHAG (Rh Family A Glycoprotein (RHAG))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHAG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RHAG antibody was raised against the middle region of RHAG

Purification: Purified

Immunogen: RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHAG Blocking Peptide, catalog no. 33R-2899, is also available for use as a blocking control in assays to test for specificity of this RHAG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHAG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHAG

Target: RHAG (Rh Family A Glycoprotein (RHAG))

Alternative Name: RHAG (RHAG Products)

Synonyms: CD241 antibody, RH2 antibody, RH50A antibody, Rh50 antibody, Rh50GP antibody, SLC42A1 antibody, Rh50A antibody, Rh-associated glycoprotein antibody, Rh associated glycoprotein antibody, Rhesus blood group-associated A glycoprotein antibody, RHAG antibody, Rhag antibody

Background: The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kDa, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kDa, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.

Molecular Weight: 45 kDa (MW of target protein)