CKM antibody (N-Term)

Catalog No. ABIN630557

Product Details anti-CKM Antibody

Target: CKM (Creatine Kinase, Muscle (CKM))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CKM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CKMM antibody was raised against the N terminal of CKM

Purification: Affinity purified

Immunogen: CKMM antibody was raised using the N terminal of CKM corresponding to a region with amino acids VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CKMM Blocking Peptide, catalog no. 33R-9549, is also available for use as a blocking control in assays to test for specificity of this CKMM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-CKM antibody (ABIN630557)

Mihm, Yu, Reiser, Bauer: "Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." in: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).

Target Details for CKM

Target: CKM (Creatine Kinase, Muscle (CKM))

Alternative Name: CKMM (CKM Products)

Synonyms: CKMM antibody, M-CK antibody, Ckmm antibody, MCK antibody, ckmm antibody, m-ck antibody, CKM antibody, CK-M antibody, cb51 antibody, ckm antibody, mck antibody, wu:fa28d05 antibody, ckm3 antibody, wu:fb55e09 antibody, zgc:64204 antibody, zgc:92070 antibody, creatine kinase, M-type antibody, creatine kinase, muscle antibody, creatine kinase, M-type L homeolog antibody, creatine kinase, muscle a antibody, creatine kinase, muscle b antibody, CKM antibody, Ckm antibody, ckm.L antibody, ckm antibody, ckma antibody, ckmb antibody

Background: CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart.

Molecular Weight: 43 kDa (MW of target protein)