FTSJ1 antibody

Catalog No. ABIN630633

Product Details anti-FTSJ1 Antibody

Target: FTSJ1 (FtsJ RNA Methyltransferase Homolog 1 (FTSJ1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FTSJ1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FTSJ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FTSJ1 Blocking Peptide, catalog no. 33R-6070, is also available for use as a blocking control in assays to test for specificity of this FTSJ1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTSJ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FTSJ1

Target: FTSJ1 (FtsJ RNA Methyltransferase Homolog 1 (FTSJ1))

Alternative Name: FTSJ1 (FTSJ1 Products)

Synonyms: AI931847 antibody, Ftsj antibody, Ftsjl antibody, Sfc12 antibody, CDLIV antibody, MRX44 antibody, MRX9 antibody, SPB1 antibody, TRMT7 antibody, RGD1561061 antibody, FtsJ RNA methyltransferase homolog 1 (E. coli) antibody, FtsJ RNA methyltransferase homolog 1 antibody, Ftsj1 antibody, FTSJ1 antibody

Background: FTSJ1 is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA.

Molecular Weight: 36 kDa (MW of target protein)