RNF20 antibody (N-Term)

Catalog No. ABIN630671

Product Details anti-RNF20 Antibody

Target: RNF20 (Ring Finger Protein 20 (RNF20))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF20 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF20 antibody was raised against the N terminal of RNF20

Purification: Affinity purified

Immunogen: RNF20 antibody was raised using the N terminal of RNF20 corresponding to a region with amino acids LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF20 Blocking Peptide, catalog no. 33R-5103, is also available for use as a blocking control in assays to test for specificity of this RNF20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF20

Target: RNF20 (Ring Finger Protein 20 (RNF20))

Alternative Name: RNF20 (RNF20 Products)

Synonyms: 4833430L21Rik antibody, AW540162 antibody, C79397 antibody, mKIAA4116 antibody, BRE1 antibody, BRE1A antibody, hBRE1 antibody, ring finger protein 20 antibody, RNF20 antibody, Rnf20 antibody

Background: RNF20 shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is an ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3.

Molecular Weight: 114 kDa (MW of target protein)