SETDB2 antibody (N-Term)
-
- Target See all SETDB2 Antibodies
- SETDB2 (SET Domain, Bifurcated 2 (SETDB2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SETDB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SETDB2 antibody was raised against the N terminal of SETDB2
- Purification
- Affinity purified
- Immunogen
- SETDB2 antibody was raised using the N terminal of SETDB2 corresponding to a region with amino acids ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE
- Top Product
- Discover our top product SETDB2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SETDB2 Blocking Peptide, catalog no. 33R-1523, is also available for use as a blocking control in assays to test for specificity of this SETDB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SETDB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SETDB2 (SET Domain, Bifurcated 2 (SETDB2))
- Alternative Name
- SETDB2 (SETDB2 Products)
- Synonyms
- C13orf4 antibody, CLLD8 antibody, CLLL8 antibody, KMT1F antibody, Clld8 antibody, Gm293 antibody, SET domain bifurcated 2 antibody, SET domain, bifurcated 2 antibody, SETDB2 antibody, Setdb2 antibody
- Background
- Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity.
- Molecular Weight
- 77 kDa (MW of target protein)
-