RSF1 antibody (Middle Region)

Catalog No. ABIN630684

Product Details anti-RSF1 Antibody

Target: RSF1 (Remodeling and Spacing Factor 1 (RSF1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RSF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RSF1 antibody was raised against the middle region of RSF1

Purification: Affinity purified

Immunogen: RSF1 antibody was raised using the middle region of RSF1 corresponding to a region with amino acids QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RSF1 Blocking Peptide, catalog no. 33R-7494, is also available for use as a blocking control in assays to test for specificity of this RSF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RSF1

Target: RSF1 (Remodeling and Spacing Factor 1 (RSF1))

Alternative Name: RSF1 (RSF1 Products)

Synonyms: Rsf-1 antibody, CG5655 antibody, Dmel\\CG5655 antibody, ROX21 antibody, RSF1 antibody, Rox21 antibody, rox21 antibody, hbxap antibody, HBXAP antibody, RSF-1 antibody, XAP8 antibody, p325 antibody, 4832420A03Rik antibody, C030033M12Rik antibody, Gm164 antibody, Hbxap antibody, remodeling and spacing factor 1 antibody, Repressor splicing factor 1 antibody, remodeling and spacing factor 1 S homeolog antibody, RSF1 antibody, Rsf1 antibody, rsf1.S antibody

Background: RSF1 (HBXAP) is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.

Molecular Weight: 164 kDa (MW of target protein)