MKRN2 antibody (C-Term)

Catalog No. ABIN630704

Product Details anti-MKRN2 Antibody

Target: MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MKRN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MKRN2 antibody was raised against the C terminal of MKRN2

Purification: Affinity purified

Immunogen: MKRN2 antibody was raised using the C terminal of MKRN2 corresponding to a region with amino acids ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MKRN2 Blocking Peptide, catalog no. 33R-1071, is also available for use as a blocking control in assays to test for specificity of this MKRN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MKRN2

Target: MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))

Alternative Name: MKRN2 (MKRN2 Products)

Synonyms: MKRN2 antibody, RNF62 antibody, MGC131105 antibody, mkrn2 antibody, Makorin-2 antibody, hspc070 antibody, wu:fb99a04 antibody, 2610002L04Rik antibody, C81377 antibody, makorin ring finger protein 2 antibody, makorin ring finger protein 2 pseudogene antibody, makorin ring finger protein 2 L homeolog antibody, makorin-2 antibody, makorin, ring finger protein, 2 antibody, MKRN2 antibody, LOC100401355 antibody, mkrn2 antibody, mkrn2.L antibody, Mkrn2 antibody

Background: Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.

Molecular Weight: 47 kDa (MW of target protein)