MORC3 antibody (N-Term)

Catalog No. ABIN630711

Product Details anti-MORC3 Antibody

Target: MORC3 (MORC Family CW-Type Zinc Finger 3 (MORC3))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MORC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MORC3 antibody was raised against the N terminal of MORC3

Purification: Affinity purified

Immunogen: MORC3 antibody was raised using the N terminal of MORC3 corresponding to a region with amino acids KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MORC3 Blocking Peptide, catalog no. 33R-4516, is also available for use as a blocking control in assays to test for specificity of this MORC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MORC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MORC3

Target: MORC3 (MORC Family CW-Type Zinc Finger 3 (MORC3))

Alternative Name: MORC3 (MORC3 Products)

Synonyms: NXP2 antibody, ZCW5 antibody, ZCWCC3 antibody, 1110051N18Rik antibody, AI452146 antibody, BF318192 antibody, D16Jhu32e antibody, Zcwcc3 antibody, sb:cb561 antibody, sb:cb69 antibody, zgc:101052 antibody, fb73c08 antibody, wu:fb73c08 antibody, zgc:162471 antibody, morc3 antibody, MORC family CW-type zinc finger 3 antibody, microrchidia 3 antibody, MORC family CW-type zinc finger 3b antibody, MORC family CW-type zinc finger 3a antibody, MORC family CW-type zinc finger 3 S homeolog antibody, MORC3 antibody, Morc3 antibody, morc3b antibody, morc3a antibody, morc3.S antibody

Background: MORC3 localizes to the nuclear matrix. Also, MORC3 has RNA binding activity, and has a predicted coiled-coil domain. The protein also has RNA binding activity, and has a predicted coiled-coil domain.

Molecular Weight: 107 kDa (MW of target protein)

Pathways: Maintenance of Protein Location