EEF1B2 antibody (Middle Region)

Catalog No. ABIN630716

Product Details anti-EEF1B2 Antibody

Target: EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EEF1B2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EEF1 B2 antibody was raised against the middle region of EEF1 2

Purification: Affinity purified

Immunogen: EEF1 B2 antibody was raised using the middle region of EEF1 2 corresponding to a region with amino acids VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EEF1B2 Blocking Peptide, catalog no. 33R-9624, is also available for use as a blocking control in assays to test for specificity of this EEF1B2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EEF1B2

Target: EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))

Alternative Name: EEF1B2 (EEF1B2 Products)

Synonyms: EEF1B antibody, EEF1B1 antibody, EF1B antibody, 2810017J07Rik antibody, Eef1b antibody, fj06d02 antibody, wu:fj06d02 antibody, zgc:56277 antibody, zgc:86802 antibody, eef1b antibody, ef1b antibody, MGC89655 antibody, eukaryotic translation elongation factor 1 beta 2 antibody, eukaryotic translation elongation factor 1 beta 2 L homeolog antibody, EEF1B2 antibody, Eef1b2 antibody, eef1b2 antibody, eef1b2.L antibody

Background: EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.

Molecular Weight: 25 kDa (MW of target protein)