MNS1 antibody (Middle Region)
-
- Target See all MNS1 Antibodies
- MNS1 (Meiosis-Specific Nuclear Structural 1 (MNS1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MNS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MNS1 antibody was raised against the middle region of MNS1
- Purification
- Affinity purified
- Immunogen
- MNS1 antibody was raised using the middle region of MNS1 corresponding to a region with amino acids KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL
- Top Product
- Discover our top product MNS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MNS1 Blocking Peptide, catalog no. 33R-4719, is also available for use as a blocking control in assays to test for specificity of this MNS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MNS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MNS1 (Meiosis-Specific Nuclear Structural 1 (MNS1))
- Alternative Name
- MNS1 (MNS1 Products)
- Synonyms
- SPATA40 antibody, sb:cb494 antibody, zgc:65845 antibody, AW546487 antibody, meiosis specific nuclear structural 1 antibody, meiosis-specific nuclear structural 1 antibody, meiosis-specific nuclear structural protein 1 antibody, MNS1 antibody, mns1 antibody, Mns1 antibody
- Background
- This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein.
- Molecular Weight
- 60 kDa (MW of target protein)
-