POLR3A antibody (Middle Region)

Catalog No. ABIN630732

Product Details anti-POLR3A Antibody

Target: POLR3A (Polymerase (RNA) III (DNA Directed) Polypeptide A, 155kDa (POLR3A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLR3A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: POLR3 A antibody was raised against the middle region of POLR3

Purification: Affinity purified

Immunogen: POLR3 A antibody was raised using the middle region of POLR3 corresponding to a region with amino acids AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLR3A Blocking Peptide, catalog no. 33R-1627, is also available for use as a blocking control in assays to test for specificity of this POLR3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLR3A

Target: POLR3A (Polymerase (RNA) III (DNA Directed) Polypeptide A, 155kDa (POLR3A))

Alternative Name: POLR3A (POLR3A Products)

Synonyms: 9330175N20Rik antibody, BC053071 antibody, RPC1 antibody, RPC155 antibody, RGD1305574 antibody, ADDH antibody, HLD7 antibody, hRPC155 antibody, polymerase (RNA) III (DNA directed) polypeptide A antibody, RNA polymerase III subunit A antibody, Polr3a antibody, POLR3A antibody

Background: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3A is the largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition.

Molecular Weight: 156 kDa (MW of target protein)