NUP43 antibody (Middle Region)

Catalog No. ABIN630751

Product Details anti-NUP43 Antibody

Target: NUP43 (Nucleoporin 43kDa (NUP43))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUP43 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NUP43 antibody was raised against the middle region of NUP43

Purification: Affinity purified

Immunogen: NUP43 antibody was raised using the middle region of NUP43 corresponding to a region with amino acids HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUP43 Blocking Peptide, catalog no. 33R-3830, is also available for use as a blocking control in assays to test for specificity of this NUP43 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUP43

Target: NUP43 (Nucleoporin 43kDa (NUP43))

Alternative Name: NUP43 (NUP43 Products)

Synonyms: MGC184722 antibody, MGC154553 antibody, 2610016K01Rik antibody, 2610529I12Rik antibody, AA409950 antibody, p42 antibody, bA350J20.1 antibody, nucleoporin 43 antibody, nucleoporin 43kDa antibody, nucleoporin Nup43 antibody, nucleoporin 43kDa S homeolog antibody, NUP43 antibody, nup43 antibody, LOC696374 antibody, nup43.S antibody, Nup43 antibody

Background: NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.

Molecular Weight: 42 kDa (MW of target protein)