HIRIP3 antibody (Middle Region)
-
- Target See all HIRIP3 Antibodies
- HIRIP3 (HIRA Interacting Protein 3 (HIRIP3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HIRIP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HIRIP3 antibody was raised against the middle region of HIRIP3
- Purification
- Affinity purified
- Immunogen
- HIRIP3 antibody was raised using the middle region of HIRIP3 corresponding to a region with amino acids RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK
- Top Product
- Discover our top product HIRIP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HIRIP3 Blocking Peptide, catalog no. 33R-8235, is also available for use as a blocking control in assays to test for specificity of this HIRIP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIRIP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HIRIP3 (HIRA Interacting Protein 3 (HIRIP3))
- Alternative Name
- HIRIP3 (HIRIP3 Products)
- Synonyms
- HIRIP3 antibody, fi16e03 antibody, wu:fi16e03 antibody, zgc:66480 antibody, B130036O03 antibody, C86302 antibody, HIRA interacting protein 3 antibody, HIRIP3 antibody, hirip3 antibody, Hirip3 antibody
- Background
- The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae.
- Molecular Weight
- 61 kDa (MW of target protein)
-