LIN7C antibody
-
- Target See all LIN7C Antibodies
- LIN7C (Lin-7 Homolog C (LIN7C))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LIN7C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
- Top Product
- Discover our top product LIN7C Primary Antibody
-
anti-Lin-7 Homolog C (LIN7C) (N-Term) antibody
LIN7C Reactivity: Human, Mouse, Rat, Rabbit, Cow, Dog, Guinea Pig, Horse, Pig, Bat, Chicken, Hamster, Monkey WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Lin-7 Homolog C (LIN7C) (AA 168-197), (C-Term) antibodyLIN7C Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB32322 unconjugated
anti-Lin-7 Homolog C (LIN7C) (N-Term) antibodyLIN7C Reactivity: Human, Mouse, Rat, Rabbit, Cow, Dog, Guinea Pig, Horse, Zebrafish (Danio rerio) WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Lin-7 Homolog C (LIN7C) (AA 108-157) antibodyLIN7C Reactivity: Human, Mouse, Rat, Rabbit, Cow, Dog, Guinea Pig, Horse, Zebrafish (Danio rerio), Pig, Bat, Chicken, Hamster, Monkey, Xenopus laevis WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Lin-7 Homolog C (LIN7C) (AA 1-70) antibodyLIN7C Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Lin-7 Homolog C (LIN7C) (AA 175-197), (C-Term) antibodyLIN7C Reactivity: Human WB, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LIN7C Blocking Peptide, catalog no. 33R-5599, is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIN7C (Lin-7 Homolog C (LIN7C))
- Alternative Name
- LIN7C (LIN7C Products)
- Synonyms
- LIN7C antibody, fb75b09 antibody, wu:fb75b09 antibody, zgc:101881 antibody, LIN-7-C antibody, LIN-7C antibody, MALS-3 antibody, MALS3 antibody, VELI3 antibody, 9130007B12Rik antibody, AI303698 antibody, AU019331 antibody, AW125731 antibody, D2Ertd520e antibody, Veli3 antibody, lin-7 homolog C, crumbs cell polarity complex component antibody, lin-7 homolog C L homeolog antibody, lin-7 homolog C (C. elegans) antibody, LIN7C antibody, lin7c.L antibody, lin7c antibody, Lin7c antibody
- Background
- LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-
