Myozenin 1 antibody (Middle Region)

Catalog No. ABIN630770

Product Details anti-Myozenin 1 Antibody

Target: Myozenin 1 (MYOZ1)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Myozenin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Myozenin 1 antibody was raised against the middle region of MYOZ1

Purification: Affinity purified

Immunogen: Myozenin 1 antibody was raised using the middle region of MYOZ1 corresponding to a region with amino acids TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Myozenin 1 Blocking Peptide, catalog no. 33R-9352, is also available for use as a blocking control in assays to test for specificity of this Myozenin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYOZ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Myozenin 1

Target: Myozenin 1 (MYOZ1)

Alternative Name: Myozenin 1 (MYOZ1 Products)

Synonyms: LOC100009016 antibody, myoz1 antibody, MGC64407 antibody, zgc:92347 antibody, MGC89225 antibody, zgc:77785 antibody, MYOZ1 antibody, CS-2 antibody, FATZ antibody, MYOZ antibody, 2310001N11Rik antibody, AV090278 antibody, Myoz antibody, RGD1561064 antibody, myozenin 1 antibody, myozenin 1 L homeolog antibody, myozenin 1b antibody, myozenin 1a antibody, MYOZ1 antibody, myoz1.L antibody, myoz1b antibody, myoz1 antibody, myoz1a antibody, Myoz1 antibody

Background: Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere.

Molecular Weight: 32 kDa (MW of target protein)