Septin 9 antibody (C-Term)

Catalog No. ABIN630783

Product Details anti-Septin 9 Antibody

Target: Septin 9 (SEPT9)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Septin 9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Septin 9 antibody was raised against the C terminal of 40430

Purification: Affinity purified

Immunogen: Septin 9 antibody was raised using the C terminal of 40430 corresponding to a region with amino acids HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40057 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Septin 9

Target: Septin 9 (SEPT9)

Alternative Name: Septin 9 (SEPT9 Products)

Synonyms: SEPT9 antibody, msf antibody, msf1 antibody, napb antibody, sint1 antibody, pnutl4 antibody, septd1 antibody, af17q25 antibody, septin-9 antibody, AF17q25 antibody, MSF antibody, MSF1 antibody, NAPB antibody, PNUTL4 antibody, SINT1 antibody, SeptD1 antibody, Msf antibody, Sint1 antibody, Eseptin antibody, Slpa antibody, cb999 antibody, fb02h06 antibody, sept9 antibody, wu:fb02h06 antibody, septin 9 antibody, septin-9 antibody, septin 9 S homeolog antibody, septin 9a antibody, SEPT9 antibody, sept9 antibody, LOC100605286 antibody, sept9.S antibody, Sept9 antibody, sept9a antibody

Background: Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain.

Molecular Weight: 37 kDa (MW of target protein)