TSPAN1 antibody (Middle Region)

Catalog No. ABIN630803

Product Details anti-TSPAN1 Antibody

Target: TSPAN1 (Tetraspanin 1 (TSPAN1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSPAN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tetraspanin 1 antibody was raised against the middle region of TSPAN1

Purification: Affinity purified

Immunogen: Tetraspanin 1 antibody was raised using the middle region of TSPAN1 corresponding to a region with amino acids TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 1 Blocking Peptide, catalog no. 33R-9202, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSPAN1

Target: TSPAN1 (Tetraspanin 1 (TSPAN1))

Alternative Name: Tetraspanin 1 (TSPAN1 Products)

Synonyms: TSPAN1 antibody, 9030418M05Rik antibody, NET1 antibody, TM4C antibody, TM4SF antibody, tetraspanin 1 antibody, tetraspanin 1 L homeolog antibody, TSPAN1 antibody, tspan1.L antibody, Tspan1 antibody

Background: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molecular Weight: 26 kDa (MW of target protein)