TRIM37 antibody (Middle Region)

Catalog No. ABIN630817

Product Details anti-TRIM37 Antibody

Target: TRIM37 (Tripartite Motif Containing 37 (TRIM37))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM37 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM37 antibody was raised against the middle region of TRIM37

Purification: Affinity purified

Immunogen: TRIM37 antibody was raised using the middle region of TRIM37 corresponding to a region with amino acids GMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM37 Blocking Peptide, catalog no. 33R-3441, is also available for use as a blocking control in assays to test for specificity of this TRIM37 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM37 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM37

Target: TRIM37 (Tripartite Motif Containing 37 (TRIM37))

Alternative Name: TRIM37 (TRIM37 Products)

Synonyms: MUL antibody, POB1 antibody, TEF3 antibody, 1110032A10Rik antibody, 2810004E07Rik antibody, AI848587 antibody, AU043018 antibody, mKIAA0898 antibody, tripartite motif-containing 37 antibody, tripartite motif containing 37 antibody, Trim37 antibody, TRIM37 antibody

Background: This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis.

Molecular Weight: 108 kDa (MW of target protein)