Transglutaminase 5 antibody (C-Term)

Catalog No. ABIN630837

Product Details anti-Transglutaminase 5 Antibody

Target: Transglutaminase 5 (TGM5)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Transglutaminase 5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Transglutaminase 5 antibody was raised against the C terminal of TGM5

Purification: Affinity purified

Immunogen: Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Transglutaminase 5 Blocking Peptide, catalog no. 33R-9671, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Transglutaminase 5

Target: Transglutaminase 5 (TGM5)

Alternative Name: Transglutaminase 5 (TGM5 Products)

Synonyms: TGM5 antibody, TGASE5 antibody, TGASEX antibody, TGMX antibody, TGX antibody, 2310007C07Rik antibody, TGx antibody, transglutaminase 5 antibody, TGM5 antibody, tgm5 antibody, Tgm5 antibody

Background: TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).

Molecular Weight: 81 kDa (MW of target protein)