TRIML1 antibody (Middle Region)
-
- Target See all TRIML1 Antibodies
- TRIML1 (Tripartite Motif Family-Like 1 (TRIML1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRIML1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRIML1 antibody was raised against the middle region of TRIML1
- Purification
- Affinity purified
- Immunogen
- TRIML1 antibody was raised using the middle region of TRIML1 corresponding to a region with amino acids DSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGV
- Top Product
- Discover our top product TRIML1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRIML1 Blocking Peptide, catalog no. 33R-2184, is also available for use as a blocking control in assays to test for specificity of this TRIML1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIML1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIML1 (Tripartite Motif Family-Like 1 (TRIML1))
- Alternative Name
- TRIML1 (TRIML1 Products)
- Synonyms
- RNF209 antibody, 4933403D14 antibody, BC050188 antibody, RGD1305337 antibody, tripartite motif family-like 1 antibody, tripartite motif family like 1 antibody, TRIML1 antibody, Triml1 antibody
- Background
- TRIML1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of the TRIML1 protein remains unknown.
- Molecular Weight
- 53 kDa (MW of target protein)
-