TNPO2 antibody
-
- Target See all TNPO2 Antibodies
- TNPO2 (Transportin 2 (TNPO2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TNPO2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIF
- Top Product
- Discover our top product TNPO2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Transportin 2 Blocking Peptide, catalog no. 33R-5883, is also available for use as a blocking control in assays to test for specificity of this Transportin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNPO2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNPO2 (Transportin 2 (TNPO2))
- Alternative Name
- Transportin 2 (TNPO2 Products)
- Synonyms
- TNPO2 antibody, IPO3 antibody, KPNB2B antibody, TRN2 antibody, ik:tdsubc_2a7 antibody, tdsubc_2a7 antibody, wu:fb01c02 antibody, wu:fe01f03 antibody, wu:fe16e12 antibody, xx:tdsubc_2a7 antibody, zgc:101009 antibody, 1110034O24Rik antibody, AA414969 antibody, AI464345 antibody, AI852433 antibody, Knpb2b antibody, Kpnb2b antibody, transportin 2 antibody, transportin 2 L homeolog antibody, transportin 2 (importin 3, karyopherin beta 2b) antibody, TNPO2 antibody, tnpo2.L antibody, Tnpo2 antibody, tnpo2 antibody
- Background
- Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.
- Molecular Weight
- 100 kDa (MW of target protein)
-