SCO1 antibody
-
- Target See all SCO1 Antibodies
- SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCO1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL
- Top Product
- Discover our top product SCO1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SCO1 Blocking Peptide, catalog no. 33R-1346, is also available for use as a blocking control in assays to test for specificity of this SCO1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCO1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))
- Alternative Name
- SCO1 (SCO1 Products)
- Synonyms
- SCOD1 antibody, 2610001C07Rik antibody, D11Bwg1310e antibody, SCO1 antibody, RGD1559538 antibody, SCO1, cytochrome c oxidase assembly protein antibody, SCO1 cytochrome c oxidase assembly protein antibody, SCO1 antibody, Sco1 antibody, sco1 antibody
- Background
- Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane.
- Molecular Weight
- 34 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Transition Metal Ion Homeostasis, Stem Cell Maintenance, Production of Molecular Mediator of Immune Response, Regulation of long-term Neuronal Synaptic Plasticity
-