PGK2 antibody (C-Term)
-
- Target See all PGK2 Antibodies
- PGK2 (Phosphoglycerate Kinase 2 (PGK2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PGK2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PGK2 antibody was raised against the C terminal of PGK2
- Purification
- Affinity purified
- Immunogen
- PGK2 antibody was raised using the C terminal of PGK2 corresponding to a region with amino acids ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
- Top Product
- Discover our top product PGK2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PGK2 Blocking Peptide, catalog no. 33R-4189, is also available for use as a blocking control in assays to test for specificity of this PGK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGK2 (Phosphoglycerate Kinase 2 (PGK2))
- Alternative Name
- PGK2 (PGK2 Products)
- Background
- PGK2 is a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP.
- Molecular Weight
- 46 kDa (MW of target protein)
-