UBE4B antibody

Catalog No. ABIN630903

Product Details anti-UBE4B Antibody

Target: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE4B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UBE4 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE4B Blocking Peptide, catalog no. 33R-8685, is also available for use as a blocking control in assays to test for specificity of this UBE4B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE4B

Target: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Alternative Name: UBE4B (UBE4B Products)

Synonyms: ufd2a antibody, E4 antibody, HDNB1 antibody, UBOX3 antibody, UFD2 antibody, UFD2A antibody, 4930551I19Rik antibody, 4933406G05Rik antibody, AU014668 antibody, D4Bwg0973e antibody, UFD2a antibody, Ufd2p antibody, mKIAA0684 antibody, ubiquitination factor E4B antibody, putative ubiquitin conjugation factor E4 B antibody, ubiquitin conjugation factor E4 B antibody, ubiquitination factor E4B, UFD2 homolog (S. cerevisiae) antibody, Ube4b antibody, LINJ_30_1070 antibody, LBRM_30_1130 antibody, Tsp_12732 antibody, Tsp_01624 antibody, ube4b antibody, UBE4B antibody

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes.

Molecular Weight: 146 kDa (MW of target protein)