GAMT antibody (Middle Region)
-
- Target See all GAMT Antibodies
- GAMT (Guanidinoacetate N-Methyltransferase (GAMT))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GAMT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GAMT antibody was raised against the middle region of GAMT
- Purification
- Affinity purified
- Immunogen
- GAMT antibody was raised using the middle region of GAMT corresponding to a region with amino acids PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI
- Top Product
- Discover our top product GAMT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GAMT Blocking Peptide, catalog no. 33R-7098, is also available for use as a blocking control in assays to test for specificity of this GAMT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAMT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GAMT (Guanidinoacetate N-Methyltransferase (GAMT))
- Alternative Name
- GAMT (GAMT Products)
- Synonyms
- gamt antibody, zgc:123136 antibody, CCDS2 antibody, PIG2 antibody, TP53I2 antibody, AA571402 antibody, Spintz1 antibody, MGC75698 antibody, GAMT antibody, GMT antibody, guanidinoacetate N-methyltransferase L homeolog antibody, guanidinoacetate N-methyltransferase S homeolog antibody, guanidinoacetate N-methyltransferase antibody, guanidinoacetate methyltransferase antibody, gamt.L antibody, gamt.S antibody, gamt antibody, GAMT antibody, Gamt antibody
- Background
- GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia.
- Molecular Weight
- 29 kDa (MW of target protein)
-