PSMB1 antibody

Catalog No. ABIN630913

Product Details anti-PSMB1 Antibody

Target: PSMB1 (Proteasome (Prosome, Macropain) Subunit, beta Type, 1 (PSMB1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMB1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PSMB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMB1 Blocking Peptide, catalog no. 33R-6806, is also available for use as a blocking control in assays to test for specificity of this PSMB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMB1

Target: PSMB1 (Proteasome (Prosome, Macropain) Subunit, beta Type, 1 (PSMB1))

Alternative Name: PSMB1 (PSMB1 Products)

Synonyms: DDBDRAFT_0217063 antibody, DDBDRAFT_0232957 antibody, DDB_0217063 antibody, DDB_0232957 antibody, AA409053 antibody, C81484 antibody, Lmpc5 antibody, HC5 antibody, PMSB1 antibody, PSC5 antibody, wu:fc51f06 antibody, zgc:103665 antibody, proteasome subunit beta 1 antibody, 20S proteasome subunit beta-1 antibody, proteasome subunit beta type 1 antibody, proteasome (prosome, macropain) subunit, beta type 1 antibody, proteasome subunit beta 1 S homeolog antibody, psmb1 antibody, PSMB1 antibody, psmB1 antibody, LOC100286342 antibody, Psmb1 antibody, psmb1.S antibody

Background: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB1 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA