PSMB3 antibody
-
- Target See all PSMB3 Antibodies
- PSMB3 (Proteasome Subunit beta 3 (PSMB3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
- Top Product
- Discover our top product PSMB3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMB3 Blocking Peptide, catalog no. 33R-5230, is also available for use as a blocking control in assays to test for specificity of this PSMB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMB3 (Proteasome Subunit beta 3 (PSMB3))
- Alternative Name
- PSMB3 (PSMB3 Products)
- Synonyms
- HC10-II antibody, AL033320 antibody, C10-II antibody, PSB3 antibody, psmb3 antibody, wu:fb11d10 antibody, wu:fu88b08 antibody, zgc:56374 antibody, DDBDRAFT_0190542 antibody, DDBDRAFT_0232932 antibody, DDB_0190542 antibody, DDB_0232932 antibody, proteasome subunit beta 3 antibody, proteasome (prosome, macropain) subunit, beta type 3 antibody, proteasome subunit C10-11 antibody, proteasome subunit beta type-3 antibody, proteasome subunit beta 3 S homeolog antibody, 20S proteasome subunit beta-3 antibody, PSMB3 antibody, Psmb3 antibody, LOC100135869 antibody, LOC399377 antibody, psmb3.S antibody, psmb3 antibody, psmB3 antibody
- Background
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.
- Molecular Weight
- 23 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Cell RedoxHomeostasis, Lipid Metabolism
-