ACTRT2 antibody (C-Term)

Catalog No. ABIN630957

Product Details anti-ACTRT2 Antibody

Target: ACTRT2 (Actin-Related Protein T2 (ACTRT2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTRT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACTRT2 antibody was raised against the C terminal of ACTRT2

Purification: Affinity purified

Immunogen: ACTRT2 antibody was raised using the C terminal of ACTRT2 corresponding to a region with amino acids LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTRT2 Blocking Peptide, catalog no. 33R-4842, is also available for use as a blocking control in assays to test for specificity of this ACTRT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTRT2

Target: ACTRT2 (Actin-Related Protein T2 (ACTRT2))

Alternative Name: ACTRT2 (ACTRT2 Products)

Synonyms: ARPM2 antibody, ARPT2 antibody, Arp-T2 antibody, HARPM2 antibody, 1700052K15Rik antibody, Arpm2 antibody, actin related protein T2 antibody, actin-related protein T2 antibody, ACTRT2 antibody, Actrt2 antibody

Background: ACTRT2 belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.

Molecular Weight: 42 kDa (MW of target protein)